RemoteCandy
JobsCompaniesRemote Resources

RemoteCandy

AboutBlogPost a JobAPISitemap

Jobs by Category

react developerpython developerproduct managerux designerdevops engineerdata scientist

Jobs by Tech Stack

reacttypescriptpythongonodejs

Interview prep by JobPrepKing.com

© 2026 RemoteCandy

Natera

Software Engineer III, Commercial Services

CountryUS Only$105,700 - $132,100Full TimeExecutive
javascalaexpressspringawsdockerterraformmysqlelasticsearchgraphqlkafkagit
Health Insurance

POSITION SUMMARY: Are you ready to make a real impact on people's lives and be a part of a rapidly-growing team? Natera is seeking a Software Engineer III to help design, develop, and maintain our Commercial Services, a critical backend microservice that powers our business operations. As a member of our engineering team, you will play a key role in processing and managing commercial services, ultimately helping to positively impact patient outcomes. Join us in our mission to change the way disease is managed, and be a part of a team of dedicated professionals who are passionate about making a difference. Software Engineer III - Commercial Services is responsible for the design, development, and maintenance of microservices that handle sales order processing and management. The role requires strong expertise in Java and Spring Boot, working with GraphQL APIs and event-driven architectures in a rapidly changing environment and the ability to adapt quickly to new technologies and systems. PRIMARY RESPONSIBILITIES: Participate in design and technical implementation decisions and help guide key stakeholders on the team to ensure that design and technical decisions meet a high standard of excellence and ensure robust order processing capabilities Work closely with Product Managers to gather requirements, walk through the design with stakeholders, and support software all the way from initial ideation to release, operation, and maintenance Participate in designing, building, and maintaining highly available systems to support our business applications, order processing, and integration with other services Support QA activities in conjunction with our QA engineering teams QUALIFICATIONS: 5+ years of overall software development experience, with focus on building secure, scalable backend services using Java and Spring Boot Strong experience with event-driven architecture and message processing using Apache Kafka Experience with software development lifecycle processes including building, software configuration, releases and deployment activities Extensive knowledge and experience with Test-Driven Development and/or Domain-Driven Development Experience with service-oriented and microservice architecture Experience building, maintaining, troubleshooting, and expanding software within the AWS ecosystem: EC2, ECS, Lambda, Step Functions, SQS, SNS, S3, etc Experience with GraphQL API design and implementation in Java Strong relational database skills including database design and optimization Strong AI and tooling skills Demonstrated teamwork skills with a solid analytical background Excellent organizational, communication, presentation, and facilitation skills KNOWLEDGE, SKILLS, AND ABILITIES: Java Programming with Spring Boot expertise SQL and NoSQL database experience including MySQL and ElasticSearch AWS Services, such as EC2, Lambdas, Step Functions, SQS, S3, and SNS Build infrastructure as code with Terraform and Cloud Formation Docker or container-oriented technologies GraphQL API development using Java Apache Kafka for event streaming Microservice Architecture CI / CD (Gitlab) Quality Assurance Mindset Experience with testing frameworks like JUnit, Mockito, Jest Familiarity with Spring ecosystem (Spring Data, Spring Security, etc.) Claude/Cursor/Codex etc The pay range is listed and actual compensation packages are based on a wide array of factors unique to each candidate, including but not limited to skill set, years & depth of experience, certifications and specific office location. This may differ in other locations due to cost of labor considerations.Remote USA$105,700—$132,100 USD OUR OPPORTUNITY Natera™ is a global leader in cell-free DNA (cfDNA) testing, dedicated to oncology, women’s health, and organ health. Our aim is to make personalized genetic testing and diagnostics part of the standard of care to protect health and enable earlier and more targeted interventions that lead to longer, healthier lives. The Natera team consists of highly dedicated statisticians, geneticists, doctors, laboratory scientists, business professionals, software engineers and many other professionals from world-class institutions, who care deeply for our work and each other. When you join Natera, you’ll work hard and grow quickly. Working alongside the elite of the industry, you’ll be stretched and challenged, and take pride in being part of a company that is changing the landscape of genetic disease management. WHAT WE OFFER Competitive Benefits - Employee benefits include comprehensive medical, dental, vision, life and disability plans for eligible employees and their dependents. Additionally, Natera employees and their immediate families receive free testing in addition to fertility care benefits. Other benefits include pregnancy and baby bonding leave, 401k benefits, commuter benefits and much more. We also offer a generous employee referral program! For more information, visit www.natera.com . Natera is proud to be an Equal Opportunity Employer. We are committed to ensuring a diverse and inclusive workplace environment, and welcome people of different backgrounds, experiences, abilities and perspectives. Inclusive collaboration benefits our employees, our community and our patients, and is critical to our mission of changing the management of disease worldwide. All qualified applicants are encouraged to apply, and will be considered without regard to race, color, religion, gender, gender identity or expression, sexual orientation, national origin, genetics, age, veteran status, disability or any other legally protected status. We also consider qualified applicants regardless of criminal histories, consistent with applicable laws. If you are based in California, we encourage you to read this important information for California residents. Link: https://www.natera.com/notice-of-data-collection-california-residents/ Please be advised that Natera will reach out to candidates with a @ natera.com email domain ONLY. Email communications from all other domain names are not from Natera or its employees and are fraudulent. Natera does not request interviews via text messages and does not ask for personal information until a candidate has engaged with the company and has spoken to a recruiter and the hiring team. Natera takes cyber crimes seriously, and will collaborate with law enforcement authorities to prosecute any related cyber crimes. For more information: - BBB announcement on job scams - FBI Cyber Crime resource page

📊 Job Intelligence

🔄 Refreshed recently

Actively recruiting right now — good time to apply

💰 Above average salary

Compensation is competitive for this role

🎯 Preparing for this interview?

Get role-specific prep at JobPrepKing.com

Start Interview Prep →

Company openings

3 active roles at this company.